missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ FKBP7 Recombinant Protein
Marca: Abnova™ H00051661-P01.10ug
Detalles adicionales : Peso : 0.00010kg
Descripción
ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array
Especificaciones
AAH09711.1 | |
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer | |
50.05 | |
8 | |
Glutathione Sepharose 4 Fast Flow | |
10 ug | |
MPKTMHFLFRFIVFFYLWGLFTAQRQKKEESTEEVKIEVLHRPENCSKTSKKGDLLNAHYDGYLAKDGSKFYCSRTQNEGHPKWFVLGVGQVIKGLDIAMTDMCPGEKRKVVIPPSFAYGKEGYAEGKIPPDATLIFEIELYAVTKGPRSIETFKQIDMDNDRQLSKAEINLYLQREFEKDEKPRDKSYQDAVLEDIFKKNDHDGDGFISPKEYNVYQHDEL | |
FKBP23/MGC9420/PPIase | |
FKBP7 | |
Wheat Germ (in vitro) | |
GST |
Antibody Production, Protein Array, ELISA, Western Blot | |
51661 | |
FKBP7 (Human) Recombinant Protein (P01) | |
In vitro wheat germ expression system | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
Wheat Germ (in vitro) | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
FKBP7 | |
Human | |
Recombinant | |
Solution |