missing translation for 'onlineSavingsMsg'
Learn More

FIH-1/HIF-1AN Antibody, Novus Biologicals™

Código de producto. 18270281 Tienda Bio Techne Productos
Change view
Click to view available options
Cantidad:
100 μL
25 μL
Tamaño de la unidad:
100 microlitros
25 microlitros
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad unitSize
18270281 100 μL 100 microlitros
18692948 25 μL 25 microlitros
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 18270281 Proveedor Novus Biologicals N.º de proveedor NBP254749

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Rabbit Polyclonal Antibody

FIH-1/HIF-1AN Polyclonal specifically detects FIH-1/HIF-1AN in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Especificaciones

Antígeno FIH-1/HIF-1AN
Aplicaciones Immunohistochemistry (Paraffin)
Clasificación Polyclonal
Conjugado Unconjugated
Dilución Immunohistochemistry-Paraffin 1:500 - 1:1000
Formulación PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Alias de gen DKFZp762F1811, EC 1.14.11.16, factor inhibiting HIF1, Factor inhibiting HIF-1, FIH1FIH-1, FLJ20615, FLJ22027, hypoxia inducible factor 1, alpha subunit inhibitor, hypoxia-inducible factor 1-alpha inhibitor, Hypoxia-inducible factor asparagine hydroxylase, peptide-aspartate beta-dioxygenase
Símbolos de los genes HIF1AN
Especie del huésped Rabbit
Inmunógeno This antibody was developed against a Recombinant Protein corresponding to amino acids:YLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKI
Método de purificación Affinity Purified
Cantidad 100 μL
Estado normativo RUO
Disciplina de investigación Angiogenesis, Cancer, Chromatin Research, Hypoxia, Transcription Factors and Regulators
Primario o secundario Primary
ID de gen (Entrez) 55662
Especificidad de la prueba Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Especies diana Human
Contenido y almacenamiento Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Mostrar más Mostrar menos

For Research Use Only

Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.