missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Beskrivning
FIGN Monoclonal antibody specifically detects FIGN in Human samples. It is validated for ELISA,Western Blot
Specifikationer
Specifikationer
| Antígeno | FIGN |
| Aplicaciones | ELISA, Western Blot |
| Clasificación | Monoclonal |
| Clon | 2F8 |
| Conjugado | Unconjugated |
| Formulación | In 1x PBS, pH 7.4 |
| N.º de referencia del gen | NP_060556.2 |
| Alias de gen | fidgetin |
| Especie del huésped | Mouse |
| Inmunógeno | FIGN (NP_060556.2, 77 a.a. ∽ 170 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GILEGPVDRPVLSNYSDTPSGLVNGRKNESEPWQPSLNSEAVYPMNCVPDVITASKAGVSSALPPADVSASIGSSPGVASNLTEPSYSSSTCGS |
| Visa mer |
Produkttitel
Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.
Hittar du en möjlighet till förbättring?