missing translation for 'onlineSavingsMsg'
Learn More

FGFR1 Antibody, Novus Biologicals™

Código de producto. 18180175 Tienda Bio Techne Productos
Change view
Click to view available options
Cantidad:
0.1 mL
25 μL
Tamaño de la unidad:
0.10 ml
25 microlitros
Código de producto. Cantidad unitSize
18180175 0.1 mL 0.10 ml
18447831 25 μL 25 microlitros
2 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 18180175

Marca: Novus Biologicals NBP233784

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Rabbit Polyclonal Antibody

FGFR1 Polyclonal specifically detects FGFR1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Especificaciones

Antígeno FGFR1
Aplicaciones Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Clasificación Polyclonal
Conjugado Unconjugated
Dilución Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulación PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
N.º de referencia del gen P11362
Alias de gen basic fibroblast growth factor receptor 1, BFGFR, bFGF-R-1, CD331, CD331 antigen, CEK, EC 2.7.10, EC 2.7.10.1, FGFBR, FGFR-1, fibroblast growth factor receptor 1, FLGH3, FLJ99988, FLT-2, FLT2H4, Fms-like tyrosine kinase 2, fms-related tyrosine kinase 2, H2, H5, HBGFR, heparin-binding growth factor receptor, hydroxyaryl-protein kinase, KAL 2, KAL2, N-SAM, OGD, Proto-oncogene c-Fgr, soluble FGFR1 variant 1, soluble FGFR1 variant 2
Símbolos de los genes FGFR1
Especie del huésped Rabbit
Inmunógeno This antibody was developed against a recombinant protein corresponding to amino acids: LPEQAQPWGAPVEVESFLVHPGDLLQLRCRLRDDVQSINWLRDGVQLAESNRTR
Método de purificación Affinity Purified
Cantidad 0.1 mL
Estado normativo RUO
Disciplina de investigación Angiogenesis, Apoptosis, Core ESC Like Genes, Protein Kinase, Signal Transduction, Stem Cell Markers
Primario o secundario Primary
ID de gen (Entrez) 2260
Especificidad de la prueba Specificity of human FGFR1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Especies diana Human
Contenido y almacenamiento Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Mostrar más Mostrar menos

For Research Use Only

Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.