missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticuerpos
  4. Anticuerpos primarios
  5. Todos los anticuerpos primarios
  6. FCRN/FCGRT Antibody, Novus Biologicals™

FCRN/FCGRT Antibody, Novus Biologicals™

Código de producto. 18441971 Tienda Bio Techne Productos
Change view
Click to view available options
Cantidad:
25 μL
Tamaño de la unidad:
0.10 ml
25 microlitros
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad unitSize
18441971 25 μL 25 microlitros
18739893 - 0.10 ml
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 18441971 Proveedor Novus Biologicals N.º de proveedor NBP18912825ul

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Rabbit Polyclonal Antibody

FCRN/FCGRT Polyclonal specifically detects FCRN/FCGRT in Human, Cynomolgus Monkey samples. It is validated for Western Blot, Simple Western, Immunohistochemistry, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen, Knockout Validated.
TRUSTED_SUSTAINABILITY

Especificaciones

Antígeno FCRN/FCGRT
Aplicaciones Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunohistochemistry (Frozen)
Clasificación Polyclonal
Conjugado Unconjugated
Dilución Western Blot 0.04 - 0.4 ug/ml, Simple Western 1:20, Immunohistochemistry 1:5000 - 1:10000, Immunohistochemistry-Paraffin 1:5000 - 1:10000, Immunohistochemistry-Frozen Reported in scientific literature (PMID 24278022)., Knockout Validated
Formulación PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
N.º de referencia del gen P55899
Alias de gen alpha-chain, Fc fragment of IgG, receptor, transporter, alpha, FcRn, FcRn alpha chain, FCRNimmunoglobulin receptor, intestinal, heavy chain, IgG Fc fragment receptor transporter alpha chain, IgG receptor FcRn large subunit p51, major histocompatibility complex class I-like Fc receptor, Neonatal Fc receptor, neonatal Fc-receptor for Ig
Símbolos de los genes FCGRT
Especie del huésped Rabbit
Inmunógeno This antibody was developed against Recombinant Protein corresponding to amino acids:LTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPSSPGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVELESPAKS
Peso molecular del antígeno 40 kDa
Método de purificación Affinity Purified
Cantidad 25 μL
Estado normativo RUO
Disciplina de investigación Immunology
Primario o secundario Primary
ID de gen (Entrez) 2217
Especificidad de la prueba Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Especies diana Human, Cynomolgus Monkey
Contenido y almacenamiento Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Mostrar más Mostrar menos

For Research Use Only

Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.