missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ FAU (Human) Recombinant Protein
Human FAU full-length ORF ( AAH33877, 1 a.a. - 133 a.a.) recombinant protein with GST-tag at N-terminal.
Marca: Abnova™ H00002197-P01.10ug
Detalles adicionales : Peso : 0.00010kg
Descripción
- Sequence: MQLFVRAQELHTFEVTGQETVAQIKAHVASLEGIAPEDQVVLLAGAPLEDEATLGQCGVEALTTQEVAGRMLGGKVHGSLARAGKVRGQTPKVAKQEKKKKKTGRAKRRMQYNRRFVNVVPTFGKKKGPNANS
Especificaciones
| AAH33877 | |
| Finkel-Biskis-Reilly murine sarcoma virus (FBR-MuSV) ubiquitously expressed | |
| 125% SDS-PAGE Stained with Coomassie Blue | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| FAU | |
| GST |
| 2197 | |
| Wheat germ expression system | |
| 10 μg | |
| FAU1, FLJ22986, Fub1, Fubi, MNSFbeta, RPS30 | |
| Wheat Germ (in vitro) | |
| 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer |