missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticuerpos
  4. Anticuerpos primarios
  5. Todos los anticuerpos primarios
  6. FAM46A Antibody, Novus Biologicals™

FAM46A Antibody, Novus Biologicals™

Código de producto. 18689167 Tienda Bio Techne Productos
Change view
Click to view available options
Cantidad:
0.1 mL
25 μL
Tamaño de la unidad:
0.10 ml
25 microlitros
Código de producto. Cantidad unitSize
18689167 25 μL 25 microlitros
18692957 0.1 mL 0.10 ml
2 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 18689167

Marca: Novus Biologicals NBP24950725ul

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Description

Rabbit Polyclonal Antibody

FAM46A Polyclonal antibody specifically detects FAM46A in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antígeno FAM46A
Aplicaciones Immunohistochemistry, Immunohistochemistry (Paraffin)
Clasificación Polyclonal
Conjugado Unconjugated
Dilución Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
Formulación PBS (pH 7.2), 40% Glycerol
Alias de gen C6orf37, chromosome 6 open reading frame 37, family with sequence similarity 46, member A, FLJ20037, FLJ31495, HBV XAg-transactivated protein 11, HBV X-transactivated gene 11 protein, hypothetical protein LOC55603, retinal expressed gene C6orf37, XTP11
Especie del huésped Rabbit
Inmunógeno This antibody was developed against a recombinant protein corresponding to amino acids: GYFAMSEDELACSPYIPLGGDFGGGGSFGGHCLDYCESPTAHCNVLNWEQVQRLDGILSETI
Método de purificación Immunogen affinity purified
Cantidad 25 μL
Estado normativo RUO
Disciplina de investigación Cell Biology
Primario o secundario Primary
ID de gen (Entrez) 55603
Especies diana Human
Contenido y almacenamiento Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Formulario Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.