missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticuerpos
  4. Anticuerpos primarios
  5. Todos los anticuerpos primarios
  6. EPB42 Antibody, Novus Biologicals™

EPB42 Antibody, Novus Biologicals™

Product Code. 18251275 Shop All Bio Techne Products
Change view
Click to view available options
Cantidad:
100 μL
Unit Size:
100 microlitros
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Cantidad unitSize
18251275 100 μL 100 microlitros
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18251275 Supplier Novus Biologicals Supplier No. NBP156647

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

EPB42 Polyclonal specifically detects EPB42 in Human samples. It is validated for Western Blot.
TRUSTED_SUSTAINABILITY

Specifications

Antígeno EPB42
Aplicaciones Western Blot
Clasificación Polyclonal
Concentración 0.5 mg/ml
Conjugado Unconjugated
Dilución Western Blot 1.0 ug/ml
Formulación PBS, 2% Sucrose with 0.09% Sodium Azide
N.º de referencia del gen P16452-2
Alias de gen E42P, erythrocyte membrane protein band 4.2, Erythrocyte protein 4.2, erythrocyte surface protein band 4.2, MGC116735, MGC116737, P4.2, PA, SPH5
Símbolos de los genes EPB42
Especie del huésped Rabbit
Inmunógeno Synthetic peptides corresponding to EPB42 (erythrocyte membrane protein band 4.2) The peptide sequence was selected from the middle region of EPB42. Peptide sequence ISTKGVGSDRCEDITQNYKYPEGSLQEKEVLERVEKEKMEREKDNGIRPP.
Peso molecular del antígeno 80 kDa
Método de purificación Affinity purified
Cantidad 100 μL
Estado normativo RUO
Primario o secundario Primary
ID de gen (Entrez) 2038
Reconstitución Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Especies diana Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
Contenido y almacenamiento Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.