missing translation for 'onlineSavingsMsg'
Learn More

Endorepellin/Perlecan/Heparan Sulfate Proteoglycan Rabbit anti-Human, Polyclonal, Novus Biologicals™

Código de producto. 18372594 Tienda Bio Techne Productos
Change view
Click to view available options
Cantidad:
100 μg
25 μg
Tamaño de la unidad:
100 microlitros
25 microlitros
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad unitSize
18372594 100 μg 100 microlitros
18341824 25 μg 25 microlitros
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 18372594 Proveedor Novus Biologicals N.º de proveedor NBP317840100UL

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Rabbit Polyclonal Antibody

Endorepellin/Perlecan/Heparan Sulfate Proteoglycan Polyclonal antibody specifically detects Endorepellin/Perlecan/Heparan Sulfate Proteoglycan in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Especificaciones

Antígeno Endorepellin/Perlecan/Heparan Sulfate Proteoglycan
Aplicaciones Immunohistochemistry, Immunohistochemistry (Paraffin)
Clasificación Polyclonal
Conjugado Unconjugated
Dilución Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
Formulación PBS, pH 7.2, 40% glycerol
Alias de gen basement membrane-specific heparan sulfate proteoglycan core protein, endorepellin (domain V region), heparan sulfate proteoglycan 2, HSPG, perlecan, perlecan proteoglycan, PLCSchwartz-Jampel syndrome 1 (chondrodystrophic myotonia), PRCAN, SJA, SJS, SJS1
Especie del huésped Rabbit
Inmunógeno This antibody was developed against Recombinant Protein corresponding to amino acids: RGMVFGIPDGVLELVPQRGPCPDGHFYLEHSAACLPCFCFGITSVCQSTRRFRDQIRLRFDQPDDFKGVNVTMPAQPGTPPLSSTQLQIDPSL
Método de purificación Affinity purified
Cantidad 100 μg
Estado normativo RUO
Disciplina de investigación Cell Biology
Primario o secundario Primary
ID de gen (Entrez) 3339
Especies diana Human
Contenido y almacenamiento Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Formulario Purified
Isotype IgG
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.