missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Endophilin A1/SH3GL2 Antibody (2G6), Novus Biologicals™
Mouse Monoclonal Antibody
Marca: Novus Biologicals H00006456-M06
Este artículo no se puede devolver.
Vea la política de devoluciones
Description
Endophilin A1/SH3GL2 Monoclonal antibody specifically detects Endophilin A1/SH3GL2 in Human, Rat samples. It is validated for Western Blot, ELISA
Spécification
| Endophilin A1/SH3GL2 | |
| Monoclonal | |
| Unconjugated | |
| NP_003017 | |
| Mouse | |
| IgG purified | |
| RUO | |
| Primary | |
| Human, Rat | |
| Purified |
| Western Blot, ELISA | |
| 2G6 | |
| In 1x PBS, pH 7.4 | |
| CNSA2FLJ25015, EEN-B1bA335L15.1 (SH3-domain GRB2-like 2), Endophilin-1, endophilin-A1, FLJ20276, SH3 domain protein 2A, SH3 domain-containing GRB2-like protein 2, SH3D2AEndophilin A1 BAR domain, SH3-domain GRB2-like 2, SH3P4endophilin-1 | |
| SH3GL2 (NP_003017, 64 a.a. ~ 124 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SRAKLSMINTMSKIRGQEKGPGYPQAEALLAEAMLKFGRELGDDCNFGPALGEVGEAMREL | |
| 0.1 mg | |
| Cancer | |
| 6456 | |
| Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles. | |
| IgG2a κ |
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu