missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Reactivos bioquímicos
  4. Péptidos
  5. 18380261

Novus Biologicals™ ELP2 Recombinant Protein Antigen

Código de producto. 18380261 Tienda Bio Techne Productos
Click to view available options
Cantidad:
0,1 mL
Tamaño de la unidad:
0.10 ml
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 18380261

Marca: Novus Biologicals™ NBP183819PEP

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ELP2. The ELP2 Recombinant Protein Antigen is derived from E. coli. The ELP2 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

This is a blocking peptide for NBP1-83819. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.

TRUSTED_SUSTAINABILITY

Especificaciones

Gene ID (Entrez) 55250
Especie Human
Método de purificación Chromatography
Pureza >80%
Concentración 0.5mg/mL
Contenido y almacenamiento Store at -20°C. Avoid freeze-thaw cycles.
Formulación PBS and 1M Urea, pH 7.4.
Para utilizar con (aplicación) Blocking/Neutralizing, Control
Símbolo de gen ELP2
Tipo de etiqueta Unlabeled
Peso molecular 32kDa
Tipo de producto ELP2
Cantidad 0,1 mL
Estado normativo RUO
Fuente E.Coli
Reactividad específica This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-83819. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Inmunógeno ECDSTDDCIEHNIGPCSSVLDVGGAVTAVSVCPVLHPSQRYVVAVGLECGKICLYTWKKTDQVPEINDWTHCVETSQSQSHTLAIRKLCWKNCSGKTEQKEAEGAEWLHFASCGEDHTVKIHRVNKCA
Mostrar más Mostrar menos

Para uso exclusivo en investigación

Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.