missing translation for 'onlineSavingsMsg'
Learn More
Learn More
EEF1A2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marca: Novus Biologicals NBP2-33983-25ul
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
EEF1A2 Polyclonal specifically detects EEF1A2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Especificaciones
| EEF1A2 | |
| Polyclonal | |
| Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| Q05639 | |
| EEF1A2 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: PGMVVTFAPVNITTEVKSVEMHHEALSEALPGDNVGFNVKNVSVKDIRR | |
| 25 μL | |
| Cellular Signaling, Oncogenes, Transcription Factors and Regulators | |
| 1917 | |
| Human | |
| IgG |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| eEF1A-2, EEF1ALFLJ41696, EF1A, EF-1-alpha-2, elongation factor 1-alpha 2, elongation factor-1 alpha, Eukaryotic elongation factor 1 A-2, eukaryotic translation elongation factor 1 alpha 2, HS1, statin, statin S1, statin-like, Statin-S1, STN, STNL | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
For Research Use Only
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido