missing translation for 'onlineSavingsMsg'
Learn More
Learn More
EDC4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
590.10€
Especificaciones
| Antígeno | EDC4 |
|---|---|
| Aplicaciones | Immunocytochemistry, Immunofluorescence |
| Clasificación | Polyclonal |
| Conjugado | Unconjugated |
| Especie del huésped | Rabbit |
| Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
|---|---|---|---|---|---|---|---|---|---|
| Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
|
18279441
|
Novus Biologicals
NBP2-55530 |
100 μL |
 624.00€ 590.10€ / 100 microlitros Ahorro 33.90€ 5% Descuento |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | |||||
Descripción
EDC4 Polyclonal specifically detects EDC4 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Especificaciones
| EDC4 | |
| Polyclonal | |
| Rabbit | |
| GPCR, Neuroscience | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 23644 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:QRKVLYVMELLQNQEEGHACFSSISEFLLTHPVLSFGIQVVSRCRLRHTEVLPAEEENDSLGADGTHGAGAMESAAGVLIKLFCVHTKALQDVQIRFQPQLNPDVVAP | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| Autoantigen Ge-1, Autoantigen RCD-8, enhancer of mRNA decapping 4, enhancer of mRNA-decapping protein 4, Ge-1, Hedls, HEDLSHuman enhancer of decapping large subunit, RCD-8 | |
| EDC4 | |
| IgG | |
| Affinity Purified |
For Research Use Only
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto