missing translation for 'onlineSavingsMsg'
Learn More
Learn More
EDC4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marca: Novus Biologicals NBP2-55530
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
EDC4 Polyclonal specifically detects EDC4 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Especificaciones
| EDC4 | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 1-4 ug/ml | |
| Autoantigen Ge-1, Autoantigen RCD-8, enhancer of mRNA decapping 4, enhancer of mRNA-decapping protein 4, Ge-1, Hedls, HEDLSHuman enhancer of decapping large subunit, RCD-8 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| EDC4 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:QRKVLYVMELLQNQEEGHACFSSISEFLLTHPVLSFGIQVVSRCRLRHTEVLPAEEENDSLGADGTHGAGAMESAAGVLIKLFCVHTKALQDVQIRFQPQLNPDVVAP | |
| 100 μL | |
| GPCR, Neuroscience | |
| 23644 | |
| Human | |
| IgG |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
For Research Use Only
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido