missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticuerpos
  4. Anticuerpos primarios
  5. Todos los anticuerpos primarios
  6. ECT2 Antibody, Novus Biologicals™

ECT2 Antibody, Novus Biologicals™

Código de producto. 18678966 Tienda Bio Techne Productos
Change view
Click to view available options
Cantidad:
100 μg
25 μL
Tamaño de la unidad:
100 microlitros
25 microlitros
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad unitSize
18678966 100 μg 100 microlitros
18639927 25 μL 25 microlitros
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 18678966 Proveedor Novus Biologicals N.º de proveedor NBP268630

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Rabbit Polyclonal Antibody

ECT2 Polyclonal antibody specifically detects ECT2 in Human samples. It is validated for Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Especificaciones

Antígeno ECT2
Aplicaciones Immunofluorescence
Clasificación Polyclonal
Conjugado Unconjugated
Dilución Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL
Formulación PBS (pH 7.2) and 40% Glycerol
Alias de gen ARHGEF31, epithelial cell transforming sequence 2 oncogene, Epithelial cell-transforming sequence 2 oncogene, FLJ10461, MGC138291, protein ECT2
Especie del huésped Rabbit
Inmunógeno This antibody was developed against a recombinant protein corresponding to amino acids: SLKEVMTHINEDKRKTEAQKQIFDVVYEVDGCPANLLSSHRSLVQRVETISLGEHPCDRGEQVTLFLFNDCLEIARKRHKVIGTFRSPH
Método de purificación Protein A purified
Cantidad 100 μg
Estado normativo RUO
Disciplina de investigación Phospho Specific
Primario o secundario Primary
ID de gen (Entrez) 1894
Especies diana Human
Contenido y almacenamiento Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Formulario Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.