missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ECT2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marca: Novus Biologicals NBP2-68630-25ul
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
ECT2 Polyclonal antibody specifically detects ECT2 in Human samples. It is validated for Immunocytochemistry/ Immunofluorescence
Especificaciones
| ECT2 | |
| Polyclonal | |
| Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL | |
| ARHGEF31, epithelial cell transforming sequence 2 oncogene, Epithelial cell-transforming sequence 2 oncogene, FLJ10461, MGC138291, protein ECT2 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: SLKEVMTHINEDKRKTEAQKQIFDVVYEVDGCPANLLSSHRSLVQRVETISLGEHPCDRGEQVTLFLFNDCLEIARKRHKVIGTFRSPH | |
| 25 μL | |
| Phospho Specific | |
| 1894 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Protein A purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido