missing translation for 'onlineSavingsMsg'
Learn More

Novus Biologicals™ EARS2 Recombinant Protein Antigen

Código de producto. 18087468 Tienda Bio Techne Productos
Click to view available options
Cantidad:
0,1 mL
Tamaño de la unidad:
0.10 ml
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 18087468

Marca: Novus Biologicals™ NBP191856PEP

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human EARS2. The EARS2 Recombinant Protein Antigen is derived from E. coli. The EARS2 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

This is a blocking peptide for NBP1-91856. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.

TRUSTED_SUSTAINABILITY

Especificaciones

Gene ID (Entrez) 124454
Especie Human
Método de purificación Chromatography
Pureza >80%
Concentración 0.5mg/mL
Contenido y almacenamiento Store at -20°C. Avoid freeze-thaw cycles.
Formulación PBS and 1M Urea, pH 7.4.
Para utilizar con (aplicación) Blocking/Neutralizing, Control
Símbolo de gen EARS2
Tipo de etiqueta Unlabeled
Peso molecular 28kDa
Tipo de producto EARS2
Cantidad 0,1 mL
Estado normativo RUO
Fuente E.Coli
Reactividad específica This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-91856. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Inmunógeno LLDLEKLPEFNRLHLQRLVSNESQRRQLVGKLQVLVEEAFGCQLQNRDVLNPVYVERILLLRQGHICRLQDLVSPVYSYLWTRPAVGRAQ
Mostrar más Mostrar menos

Para uso exclusivo en investigación

Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado