missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticuerpos
  4. Anticuerpos primarios
  5. Todos los anticuerpos primarios
  6. 18312169

EAAT2/GLT1 Antibody (4G8), Novus Biologicals™

Código de producto. 18312169 Tienda Bio Techne Productos
Change view
Click to view available options
Cantidad:
0.1 mg
Tamaño de la unidad:
0.01 miligramo
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad unitSize
18312169 0.1 mg 0.01 miligramo
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 18312169 Proveedor Novus Biologicals N.º de proveedor H00006506M10

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Mouse Monoclonal Antibody

EAAT2/GLT1 Monoclonal antibody specifically detects EAAT2/GLT1 in Human samples. It is validated for Western Blot, ELISA
TRUSTED_SUSTAINABILITY

Especificaciones

Antígeno EAAT2/GLT1
Aplicaciones Western Blot, ELISA
Clasificación Monoclonal
Clon 4G8
Conjugado Unconjugated
Dilución Western Blot, ELISA
Formulación In 1x PBS, pH 7.4
N.º de referencia del gen NP_004162
Alias de gen GLT1, member 2, solute carrier family 1 (glial high affinity glutamate transporter), member 2, Solute carrier family 1 member 2
Especie del huésped Mouse
Inmunógeno SLC1A2 (NP_004162, 160 a.a. ~ 239 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DEVSSLDAFLDLIRNLFPENLVQACFQQIQTVTKKVLVAPPPDEEANATSAVVSLLNETVTEVPEETKMVIKKGLEFKDG
Método de purificación IgG purified
Cantidad 0.1 mg
Estado normativo RUO
Disciplina de investigación Hypoxia, Neuroscience
Primario o secundario Primary
ID de gen (Entrez) 6506
Especies diana Human
Contenido y almacenamiento Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Formulario Purified
Isotype IgG2a κ
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.