missing translation for 'onlineSavingsMsg'
Learn More
Learn More
dystrophia myotonica containing WD repeat motif Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marca: Novus Biologicals NBP2-49622
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
dystrophia myotonica containing WD repeat motif Polyclonal antibody specifically detects dystrophia myotonica containing WD repeat motif in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Especificaciones
| dystrophia myotonica containing WD repeat motif | |
| Polyclonal | |
| Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| D19S593E, DM9, DMRN9, DMR-N9, dystrophia myotonica WD repeat-containing protein, dystrophia myotonica, WD repeat containing, dystrophia myotonica-containing WD repeat motif, Dystrophia myotonica-containing WD repeat motif protein, gene59, Protein 59, Protein DMR-N9 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: TYLKWLPESESLFLASHASGHLYLYNVSHPCASAPPQYSLLKQGEGFSVYA | |
| 0.1 mL | |
| Cell Cycle and Replication | |
| 1762 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido