missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ DSCR1 (Human) Recombinant Protein
Human DSCR1 full-length ORF ( AAH02864, 1 a.a. - 197 a.a.) recombinant protein with GST-tag at N-terminal.
Marca: Abnova™ H00001827-P01.10ug
Detalles adicionales : Peso : 0.00010kg
Descripción
- Sequence: MEEVDLRDLPSATIACHLDPRVFVDGLCRAKFESLFRTYDKDITFQYFKSFKRVRINFSNPFSAADARLQLHKTEFLGKEMKLYFAQTLHIGSSHLAPPNPDKQFLISPPASPPVGWKQVEDATPVINYDLLYAISKLGPGEKYELHAATDTTPSVVVHVCESDQEKEEEEEMERMRRPKPKIIQTRRPEYTQIHLS
Especificaciones
| AAH02864 | |
| regulator of calcineurin 1 | |
| 125% SDS-PAGE Stained with Coomassie Blue | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| RCAN1 | |
| GST |
| 1827 | |
| Wheat germ expression system | |
| 10 μg | |
| ADAPT78, CSP1, DSC1, DSCR1, MCIP1, RCN1 | |
| Wheat Germ (in vitro) | |
| 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer |