missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DPPA5/ESG1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marca: Novus Biologicals NBP2-38053
Código de producto. 18151908
-
624.00€
590.10€ / 0.10 ml
Ahorro 33.90€
5% Descuento
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
DPPA5/ESG1 Polyclonal specifically detects DPPA5/ESG1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Especificaciones
| DPPA5/ESG1 | |
| Polyclonal | |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| A6NC42 | |
| DPPA5 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: MGTLPARRHIPPWVKVPEDLKDPEVFQVQTRLLKAIFGPDGSRIPYIEQVS | |
| 0.1 mL | |
| Stem Cells | |
| 340168 | |
| Human | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| developmental pluripotency associated 5, developmental pluripotency-associated 5 protein, embryonal stem cell specific gene 1, Embryonal stem cell-specific gene 1 protein, Esg1, ESG1ESG-1, hDPPA5 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido