missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticuerpos
  4. Anticuerpos primarios
  5. Todos los anticuerpos primarios
  6. DDHD1 Antibody, Novus Biologicals™

DDHD1 Antibody, Novus Biologicals™

Código de producto. 18701144 Tienda Bio Techne Productos
Change view
Click to view available options
Tamaño de la unidad:
0.10 ml
25 microlitros
Cantidad:
25ul
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. unitSize Cantidad
18701144 0.10 ml -
18427471 25 microlitros 25ul
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 18701144 Proveedor Novus Biologicals N.º de proveedor NBP213903

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Rabbit Polyclonal Antibody

DDHD1 Polyclonal specifically detects DDHD1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Specifications

Aplicaciones Western Blot, Immunohistochemistry
Clasificación Polyclonal
Dilución Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
Símbolos de los genes DDHD1
Especie del huésped Rabbit
Inmunógeno This antibody was developed against a recombinant protein corresponding to the amino acids: NTAMMREAARKIEERHFSNHATHVEFLPVEWRSKLTLDGDTVDSITPDKVRGLRDMLNSSAMDIMYYTSPLYRDELVKGLQQELNRLYSLFCSRNPD
Isotype IgG

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.