missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DAX1/NR0B1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marca: Novus Biologicals NBP2-68781
Código de producto. 18676308
-
593.00€
560.70€ / 100 microlitros
Ahorro 32.30€
5% Descuento
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
DAX1/NR0B1 Polyclonal antibody specifically detects DAX1/NR0B1 in Human samples. It is validated for Immunocytochemistry/ Immunofluorescence
Especificaciones
| DAX1/NR0B1 | |
| Polyclonal | |
| Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL | |
| AHCDSS, AHCH, AHX, DAX1DAX-1, dosage-sensitive sex reversal, DSS-AHC critical region on the X chromosome protein 1, GTD, HHG, NROB1, nuclear hormone receptor, Nuclear receptor DAX-1, nuclear receptor subfamily 0 group B member 1, nuclear receptor subfamily 0, group B, member 1 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: GKDHPRQGSILYSMLTSAKQTYAAPKAPEATLGPCWGCSCGSDPGVGRAGLPGGRPVALLYRCCF | |
| 100 μg | |
| Cancer | |
| 190 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Protein A purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido