missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DAK Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marca: Novus Biologicals NBP2-48894-25ul
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
DAK Polyclonal antibody specifically detects DAK in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Especificaciones
| DAK | |
| Polyclonal | |
| Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| ATP-dependent dihydroxyacetone kinase, bifunctional ATP-dependent dihydroxyacetone kinase/FAD-AMP lyase (cyclizing), DHA kinase, Dha kinase/FMN cyclase, dihydroxyacetone kinase 2 homolog (S. cerevisiae), dihydroxyacetone kinase 2 homolog (yeast), DKFZp586B1621, FAD-AMP lyase cyclic FMN forming, FAD-AMP lyase cyclizing, glycerone kinase, MGC5621, NET45 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: PGDRTMLDSLWAAGQELQAWKSPGADLLQVLTKAVKSAEAAAEATKNMEAGAGRASYISSARLEQPDPGAVAAAAILRAIL | |
| 25 μL | |
| Lipid and Metabolism | |
| 26007 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido