missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Cyclin I Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marca: Novus Biologicals NBP2-56916-25ul
Código de producto. 18661377
-
415.00€
391.65€ / 25 microlitros
Ahorro 23.35€
5% Descuento
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
Cyclin I Polyclonal specifically detects Cyclin I in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.
Especificaciones
| Cyclin I | |
| Polyclonal | |
| Western Blot 0.4 μg/mL, Immunocytochemistry/Immunofluorescence 1-4 μg/mL | |
| CYC1, cyclin I, cyclin ITI, cyclin-I, CYI | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| IgG |
| Western Blot, Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| CCNI | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ATVKAHPKYLSCIAISCFFLAAKTVEEDERIPVLKVLARDSFCGCSSSEILRMERIILDKLNWDLHTATPLDFLH | |
| 25 μL | |
| Signal Transduction | |
| 10983 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
For Research Use Only
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido