missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticuerpos
  4. Anticuerpos primarios
  5. Todos los anticuerpos primarios
  6. CXCR1/IL-8RA Antibody, Novus Biologicals™

CXCR1/IL-8RA Antibody, Novus Biologicals™

Product Code. 18622679 Shop All Bio Techne Products
Change view
Click to view available options
Cantidad:
25 μL
0.1 mL
Unit Size:
0.10 ml
25 microlitros
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Cantidad unitSize
18622679 25 μL 25 microlitros
18642679 0.1 mL 0.10 ml
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18622679 Supplier Novus Biologicals Supplier No. NBP24862125ul

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

CXCR1/IL-8RA Polyclonal antibody specifically detects CXCR1/IL-8RA in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antígeno CXCR1/IL-8RA
Aplicaciones Immunohistochemistry, Immunohistochemistry (Paraffin)
Clasificación Polyclonal
Conjugado Unconjugated
Dilución Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
Formulación PBS (pH 7.2), 40% Glycerol
Alias de gen CD128, CD181, CD181 antigen, CDw128aC-C, chemokine (C-X-C motif) receptor 1, CKR-1, CMKAR1, C-X-C chemokine receptor type 1, CXC-R1, CXCR-1, High affinity interleukin-8 receptor A, IL-8 receptor type 1, IL-8R A, IL8R1, IL8RAC-C-CKR-1, IL8RBA, interleukin 8 receptor, alpha, interleukin-8 receptor type 1, interleukin-8 receptor type A
Especie del huésped Rabbit
Inmunógeno This antibody was developed against a recombinant protein corresponding to amino acids: MSNITDPQMWDFDDLNFTGMPPADEDYSPCMLETETLNK
Método de purificación Immunogen affinity purified
Cantidad 25 μL
Estado normativo RUO
Disciplina de investigación Chemokines and Cytokines, Cytokine Research, GPCR, Immunology, Innate Immunity, Signal Transduction
Primario o secundario Primary
ID de gen (Entrez) 3577
Especies diana Human
Contenido y almacenamiento Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Formulario Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.