missing translation for 'onlineSavingsMsg'
Learn More

CTB-133G6.1 Antibody, Novus Biologicals™

Código de producto. 18610736 Tienda Bio Techne Productos
Change view
Click to view available options
Cantidad:
0.1 mL
25 μL
Tamaño de la unidad:
0.10 ml
25 microlitros
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad unitSize
18610736 0.1 mL 0.10 ml
18693798 25 μL 25 microlitros
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 18610736 Proveedor Novus Biologicals N.º de proveedor NBP248929

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Rabbit Polyclonal Antibody

CTB-133G6.1 Polyclonal antibody specifically detects CTB-133G6.1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Especificaciones

Antígeno CTB-133G6.1
Aplicaciones Immunohistochemistry, Immunohistochemistry (Paraffin)
Clasificación Polyclonal
Conjugado Unconjugated
Dilución Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
Formulación PBS (pH 7.2), 40% Glycerol
Alias de gen 114 kDa Rho-specific guanine nucleotide exchange factor, rho guanine nucleotide exchange factor 18, Rho/Rac guanine nucleotide exchange factor (GEF) 18, Rho-specific guanine nucleotide exchange factor p114, RP78; SA-RhoGEF, p114RhoGEF, p114-RhoGEF, septin-associated RhoGEF
Especie del huésped Rabbit
Inmunógeno This antibody was developed against a recombinant protein corresponding to amino acids: LKTWTQGCLSGGGTPAESPGKECDSPKKRGRSRSVPVSFYEIRSPEISPGLEVPTPPVQGLEPPVLECMEKDHVEPDH
Método de purificación Immunogen affinity purified
Cantidad 0.1 mL
Estado normativo RUO
Primario o secundario Primary
Especies diana Human
Contenido y almacenamiento Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Formulario Purified
Isotype IgG
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.