missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticuerpos
  4. Anticuerpos primarios
  5. Todos los anticuerpos primarios
  6. CPT2 Antibody, Novus Biologicals™

CPT2 Antibody, Novus Biologicals™

Código de producto. 30231535 Tienda Bio Techne Productos
Change view
Click to view available options
Cantidad:
20 μL
100 μL
Tamaño de la unidad:
100 microlitros
20 microlitros
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Cantidad unitSize
30231535 100 μL 100 microlitros
30229809 20 μL 20 microlitros
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 30231535 Supplier Novus Biologicals Supplier No. NBP338018100ul

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

CPT2 Polyclonal antibody specifically detects CPT2 in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antígeno CPT2
Aplicaciones ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin)
Clasificación Polyclonal
Conjugado Unconjugated
Dilución Western Blot 1:100 - 1:500, ELISA, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulación PBS (pH 7.3), 50% glycerol
Alias de gen carnitine O-palmitoyltransferase 2, mitochondrial, carnitine palmitoyltransferase 2, Carnitine palmitoyltransferase IIEC 2.3.1.21, CPT II, CPT1, CPTASE
Especie del huésped Rabbit
Inmunógeno A synthetic peptide corresponding to a sequence within amino acids 420-658 of human CPT2 (NP_000089.1).,, Sequence:, VALDKQNKHTSYISGPWFDMYLSARDSVVLNFNPFMAFNPDPKSEYNDQLTRATNMTVSAIRFLKTLRAGLLEPEVFHLNPAKSDTITFKRLIRFVPSSLS
Método de purificación Affinity purified
Cantidad 100 μL
Estado normativo RUO
Disciplina de investigación Cancer, Cardiovascular Biology, Endocrinology, Signal Transduction
Primario o secundario Primary
ID de gen (Entrez) 1376
Especies diana Human, Mouse, Rat
Contenido y almacenamiento Store at -20°C. Avoid freeze-thaw cycles.
Formulario Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.