missing translation for 'onlineSavingsMsg'
Learn More

CPT2 Antibody, Novus Biologicals™

Código de producto. 18480272 Tienda Bio Techne Productos
Change view
Click to view available options
Cantidad:
0.1 mL
25 μL
Tamaño de la unidad:
0.10 ml
25 microlitros
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad unitSize
18480272 25 μL 25 microlitros
18450972 0.1 mL 0.10 ml
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 18480272 Proveedor Novus Biologicals N.º de proveedor NBP18547025ul

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Rabbit Polyclonal Antibody

CPT2 Polyclonal antibody specifically detects CPT2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Especificaciones

Antígeno CPT2
Aplicaciones Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Clasificación Polyclonal
Conjugado Unconjugated
Dilución Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50
Formulación PBS (pH 7.2) and 40% Glycerol
Alias de gen carnitine O-palmitoyltransferase 2, mitochondrial, carnitine palmitoyltransferase 2, Carnitine palmitoyltransferase IIEC 2.3.1.21, CPT II, CPT1, CPTASE
Especie del huésped Rabbit
Inmunógeno This antibody was developed against Recombinant Protein corresponding to amino acids: MMVECSKYHGQLTKEAAMGQGFDRHLFALRHLAAAKGIILPELYLDPAYGQINHNVLSTSTLSSPAVNLGGFAPVVSDGFGVGYAVHDNWIGCNVSSYP
Método de purificación Immunogen affinity purified
Cantidad 25 μL
Estado normativo RUO
Disciplina de investigación Cancer, Cardiovascular Biology, Endocrinology, Signal Transduction
Primario o secundario Primary
ID de gen (Entrez) 1376
Especies diana Human
Contenido y almacenamiento Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Formulario Purified
Isotype IgG
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.