missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CPNE2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
280.00€ - 590.10€
Especificaciones
| Antígeno | CPNE2 |
|---|---|
| Dilución | Western Blot 0.4 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Aplicaciones | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Clasificación | Polyclonal |
| Conjugado | Unconjugated |
| Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
|---|---|---|---|---|---|---|---|---|---|
| Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
|
18405192
|
Novus Biologicals
NBP2-30692-25ul |
25 μL |
280.00€
25 microlitros |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | |||||
|
18136025
|
Novus Biologicals
NBP2-30692 |
0.1 mL |
624.00€ 590.10€ / 0.10 ml Ahorro 33.90€ 5% Descuento |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | |||||
Descripción
CPNE2 Polyclonal specifically detects CPNE2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Especificaciones
| CPNE2 | |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| copine IICPN2, copine-2, COPN2, DKFZp686E06199, MGC16924 | |
| CPNE2 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot 0.4 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Q96FN4 | |
| 221184 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: YKPGDDGKWMLVHRTEVIKYTLDPVWKPFTVPLVSLCDGDMEKPIQVMCY | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto