missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CPEB4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
359.00€ - 529.00€
Especificaciones
Antígeno | CPEB4 |
---|---|
Dilución | Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml |
Aplicaciones | Immunocytochemistry, Immunofluorescence |
Clasificación | Polyclonal |
Conjugado | Unconjugated |
Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
---|---|---|---|---|---|---|---|---|---|
Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
18439010
|
Novus Biologicals
NBP1-81384-25ul |
25 ul |
359.00€
25 microlitros |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | |||||
18060004
|
Bio-Techne
NBP1-81384 |
0.1 mL |
529.00€
0.10 ml |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | |||||
Descripción
CPEB4 Polyclonal specifically detects CPEB4 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Especificaciones
CPEB4 | |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
RUO | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
80315 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:GDYGFGVLVQSNTGNKSAFPVRFHPHLQPPHHHQNATPSPAAFINNNTAANGSSA | |
Primary | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml | |
Polyclonal | |
Rabbit | |
Human | |
CPE-binding protein 4, cytoplasmic polyadenylation element binding protein 4, cytoplasmic polyadenylation element-binding protein 4, hCPEB-4, KIAA1673CPE-BP4 | |
CPEB4 | |
IgG | |
Affinity Purified | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
CPEB4 Antibody, Novus Biologicals™