missing translation for 'onlineSavingsMsg'
Learn More

Collagen XVII Antibody, Novus Biologicals™

Código de producto. 18450412 Tienda Bio Techne Productos
Change view
Click to view available options
Cantidad:
25 μL
Tamaño de la unidad:
25 microlitros
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad unitSize
18450412 25 μL 25 microlitros
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 18450412 Proveedor Novus Biologicals N.º de proveedor NBP19180025ul

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Rabbit Polyclonal Antibody has been used in 2 publications

Collagen XVII Polyclonal specifically detects Collagen XVII in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Especificaciones

Antígeno Collagen XVII
Aplicaciones Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Clasificación Polyclonal
Conjugado Unconjugated
Dilución Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:200-1:500
Formulación PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Alias de gen 180 kDa bullous pemphigoid antigen 2, BA16H23.2, BP180alpha 1 type XVII collagen, BPAG2bA16H23.2 (collagen, type XVII, alpha 1 (BP180)), Bullous pemphigoid antigen 2, bullous pemphigoid antigen 2 (180kD), Collagen 17, collagen alpha-1(XVII) chain, collagen XVII, alpha-1 polypeptide, collagen, type XVII, alpha 1, Collagen-17, FLJ60881, KIAA0204, LAD-1
Símbolos de los genes COL17A1
Especie del huésped Rabbit
Inmunógeno This antibody was developed against Recombinant Protein corresponding to amino acids:DGTEVTERIVTETVTTRLTSLPPKGGTSNGYAKTASLGGGSRLEKQSLTHGSSGYINSTGSTRGHASTSSYRRAHSPASTLPNSPGSTFERKTHVTR
Método de purificación Affinity Purified
Cantidad 25 μL
Estado normativo RUO
Primario o secundario Primary
ID de gen (Entrez) 1308
Especificidad de la prueba Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Especies diana Human
Contenido y almacenamiento Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Mostrar más Mostrar menos

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.