COL11A1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Marca: Novus Biologicals NBP2-58159

Ver más versiones de este producto

Código de producto. 18065564

574.00€
542.85€ / 100 microlitros
Ahorro 31.15€
5% Descuento

Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

COL11A1 Polyclonal specifically detects COL11A1 in Human, Mouse samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence.

Especificaciones

Antígeno	COL11A1
Clasificación	Polyclonal
Dilución	Immunohistochemistry, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Alias de gen	alpha-1 polypeptide, COLL6, collagen, type XI, alpha 1
Especie del huésped	Rabbit
Método de purificación	Affinity Purified
Estado normativo	RUO
ID de gen (Entrez)	1301
Especies diana	Human, Mouse
Isotype	IgG

Aplicaciones	Immunohistochemistry, Immunocytochemistry, Immunofluorescence
Conjugado	Unconjugated
Formulación	PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Símbolos de los genes	COL11A1
Inmunógeno	This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:DCDSSAPKAAQAQEPQIDEYAPEDIIEYDYEYGEAEYKEAESVTEGPTVTEETIAQTEANIVDDFQEYNYG
Cantidad	100 μL
Primario o secundario	Primary
Especificidad de la prueba	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Contenido y almacenamiento	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Produktvorschläge

Berichtigung von Produktinhalten

Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.

Name des Produkts

Ihr Name

E-Mail Adresse *

Art der Problems *

Detaillierte Beschreibung des Problems/der Anfrage *

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.

Abbrechen Absenden

Vielen Dank, dass Sie uns helfen, unsere Website zu verbessern. Ihr Feedback wurde übermittelt

For Research Use Only

Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur

COL11A1 Antibody, Novus Biologicals™

Descripción

Especificaciones

Produktvorschläge

Dokumentation

Aktionen