missing translation for 'onlineSavingsMsg'
Learn More

CML2 Antibody - BSA Free, Novus Biologicals™

Código de producto. p-200060915 Tienda Bio Techne Productos
Change view
Click to view available options
Cantidad:
0.02 mL
0.1 mL
Tamaño de la unidad:
0.01 ml
0.02 ml
Código de producto. Cantidad unitSize
18668891 0.02 mL 0.02 ml
18650092 0.1 mL 0.01 ml
2 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 18668891

Marca: Novus Biologicals NBP2928030.02ml

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Rabbit Polyclonal Antibody

CML2 Polyclonal antibody specifically detects CML2 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Especificaciones

Antígeno CML2
Aplicaciones Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Clasificación Polyclonal
Conjugado Unconjugated
Dilución Western Blot 1:500-1:2000, Immunohistochemistry 1:50-1:200, Immunohistochemistry-Paraffin
Formulación PBS with 50% glycerol, pH7.3.
Alias de gen Camello-like protein 2, CML2, EC 2.3.1, EC 2.3.1.-, Hcml2, MGC97061, N-acetyltransferase 8B (GCN5-related, putative, gene/pseudogene), N-acetyltransferase 8B (gene/pseudogene), N-acetyltransferase Camello 2, NAT8BP, probable N-acetyltransferase 8B
Especie del huésped Rabbit
Inmunógeno Recombinant fusion protein containing a sequence corresponding to amino acids 75-165 of human NAT8B (NP_057431.2). WFLAKKPWTRYVDIALRTDMSDITKSYLSECGSCFWVGESEEKVVGTVGALPVDDPTLREKRLQLFHLSVDNEHRGQGIAKALVRTVLQFA
Método de purificación Affinity purified
Cantidad 0.02 mL
Estado normativo RUO
Disciplina de investigación Cell Biology
Primario o secundario Primary
ID de gen (Entrez) 51471
Especies diana Human, Mouse, Rat
Contenido y almacenamiento Store at -20°C. Avoid freeze-thaw cycles.
Formulario Purified
Isotype IgG
Mostrar más Mostrar menos
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.