missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Clusterin-like 1/CLUL1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
391.65€ - 590.10€
Especificaciones
| Antígeno | Clusterin-like 1/CLUL1 |
|---|---|
| Dilución | Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL |
| Aplicaciones | Immunofluorescence |
| Clasificación | Polyclonal |
| Conjugado | Unconjugated |
| Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
|---|---|---|---|---|---|---|---|---|---|
| Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
|
18634387
|
Novus Biologicals
NBP2-69003-25ul |
25 μL |
 415.00€ 391.65€ / 25 microlitros Ahorro 23.35€ 5% Descuento |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | |||||
|
18681068
|
Novus Biologicals
NBP2-69003 |
100 μg |
624.00€ 590.10€ / 100 microlitros Ahorro 33.90€ 5% Descuento |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | |||||
Descripción
Clusterin-like 1/CLUL1 Polyclonal antibody specifically detects Clusterin-like 1/CLUL1 in Human samples. It is validated for Immunocytochemistry/ ImmunofluorescenceEspecificaciones
| Clusterin-like 1/CLUL1 | |
| Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Cell Cycle and Replication, Vision | |
| PBS (pH 7.2) and 40% Glycerol | |
| 27098 | |
| IgG | |
| Protein A purified |
| Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| clusterin-like 1 (retinal), clusterin-like protein 1, RA337M, Retinal-specific clusterin-like protein | |
| This antibody was developed against a recombinant protein corresponding to amino acids: HLRNDSNSGNMKPPLLVFIVCLLWLKDSHCAPTWKDKTAISENLKSFSEVGEIDADEEVKKALTGIKQMKIMMERKEKEHTNLMSTLKK | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto