missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticuerpos
  4. Anticuerpos primarios
  5. Todos los anticuerpos primarios
  6. Clusterin-like 1/CLUL1 Antibody, Novus Biologicals™

Clusterin-like 1/CLUL1 Antibody, Novus Biologicals™

Código de producto. 18634387 Tienda Bio Techne Productos
Change view
Click to view available options
Cantidad:
100 μg
25 μL
Tamaño de la unidad:
100 microlitros
25 microlitros
Código de producto. Cantidad unitSize
18634387 25 μL 25 microlitros
18681068 100 μg 100 microlitros
2 options
This item is not returnable. View return policy

Product Code. 18634387

Brand: Novus Biologicals NBP26900325ul

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

Clusterin-like 1/CLUL1 Polyclonal antibody specifically detects Clusterin-like 1/CLUL1 in Human samples. It is validated for Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antígeno Clusterin-like 1/CLUL1
Aplicaciones Immunofluorescence
Clasificación Polyclonal
Conjugado Unconjugated
Dilución Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL
Formulación PBS (pH 7.2) and 40% Glycerol
Alias de gen clusterin-like 1 (retinal), clusterin-like protein 1, RA337M, Retinal-specific clusterin-like protein
Especie del huésped Rabbit
Inmunógeno This antibody was developed against a recombinant protein corresponding to amino acids: HLRNDSNSGNMKPPLLVFIVCLLWLKDSHCAPTWKDKTAISENLKSFSEVGEIDADEEVKKALTGIKQMKIMMERKEKEHTNLMSTLKK
Método de purificación Protein A purified
Cantidad 25 μL
Estado normativo RUO
Disciplina de investigación Cell Cycle and Replication, Vision
Primario o secundario Primary
ID de gen (Entrez) 27098
Especies diana Human
Contenido y almacenamiento Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Formulario Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.