missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Proteínas recombinantes
  4. Abnova™ CLIC1 Recombinant Protein

Abnova™ CLIC1 Recombinant Protein

Código de producto. 16113291
Click to view available options
Cantidad:
10 μg
25 μg
Nombre:
Proteína recombinante CLIC1 (humana) (P01)
Proteína recombinante humana CLIC1 ORF de longitud completa con etiqueta GST en N-terminal
Tamaño de la unidad:
10 microgramos
25 microgramos
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 16113291

Marca: Abnova™ H00001192P01.10ug

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

CLIC1 ( AAH64527.1, 1-242aa) full-length recombinant protein with GST tag

Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. Chloride intracellular channel 1 is a member of the p64 family; the protein localizes principally to the cell nucleus and exhibits both nuclear and plasma membrane chloride ion channel activity.

  • MW: 52.6kDa
  • Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH = 8 in elution buffer

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Especificaciones

Número de acceso AAH64527.1
Para utilizar con (aplicación) Antibody Production, Protein Array, ELISA, Western Blot
Formulación 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
ID de gen (Entrez) 1192
Peso molecular 52.25
Nombre Proteína recombinante CLIC1 (humana) (P01)
Intervalo de pH 8
Método de preparación In vitro wheat germ expression system
Método de purificación Glutathione Sepharose 4 Fast Flow
Pruebas de control de calidad 12.5% SDS-PAGE Stained with Coomassie Blue.
Cantidad 10 μg
Fuente Wheat Germ (in vitro)
Inmunógeno MAEEQPQVELFVKAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQKLCPGGQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIFAKFSAYIKNSSPALNDNLEKGLLKALKVLDNYLTSPLPEEVDETSAEDEGVSQRKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFASTCPDDEEIELAYEQVAKALK
Requisitos de almacenamiento Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Alias de gen G6/NCC27
Nombre común CLIC1
Símbolo de gen CLIC1
Reactividad cruzada Human
Especie Wheat Germ (in vitro)
Recombinante Recombinant
Etiqueta de proteína GST
Formulario Solution
Mostrar más Mostrar menos
Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado