missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Claudin-5 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
212.10€ - 470.40€
Especificaciones
| Antígeno | Claudin-5 |
|---|---|
| Dilución | Western Blot 1:1000 - 1:5000, Immunocytochemistry/ Immunofluorescence 1:50 - 1:200 |
| Aplicaciones | Western Blot, Immunofluorescence |
| Clasificación | Polyclonal |
| Conjugado | Unconjugated |
| Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
|---|---|---|---|---|---|---|---|---|---|
| Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
|
18615812
|
Novus Biologicals
NBP2-92846-0.02ml |
0.02 mL |
 225.00€ 212.10€ / 0.02 ml Ahorro 12.90€ 5% Descuento |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | |||||
|
18682982
|
Novus Biologicals
NBP2-92846-0.1ml |
0.1 mL |
498.00€ 470.40€ / 0.10 ml Ahorro 27.60€ 5% Descuento |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | |||||
Descripción
Claudin-5 Polyclonal antibody specifically detects Claudin-5 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunocytochemistry/ ImmunofluorescenceEspecificaciones
| Claudin-5 | |
| Western Blot, Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Cellular Markers | |
| PBS with 50% glycerol, pH7.3. | |
| 7122 | |
| IgG | |
| Affinity purified |
| Western Blot 1:1000 - 1:5000, Immunocytochemistry/ Immunofluorescence 1:50 - 1:200 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| AWALTransmembrane protein deleted in VCFS, BEC1, claudin 5, claudin-5, CPETRL1, TMVCFTMDVCF, transmembrane protein deleted in velocardiofacial syndrome | |
| A synthetic peptide corresponding to a sequence within amino acids 119-218 of human Claudin-5 (NP_001349995.1). LTGGVLYLFCGLLALVPLCWFANIVVREFYDPSVPVSQKYELGAALYIGWAATALLMVGGCLLCCGAWVCTGRPDLSFPVKYSAPRRPTATGDYDKKNYV | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto