missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticuerpos
  4. Anticuerpos primarios
  5. Todos los anticuerpos primarios
  6. Claudin-18.2 Antibody, Novus Biologicals™

Claudin-18.2 Antibody, Novus Biologicals™

Product Code. 30230693 Shop All Bio Techne Products
Change view
Click to view available options
Cantidad:
20 μL
100 μL
Unit Size:
100 microlitros
20 microlitros
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Cantidad unitSize
30230693 20 μL 20 microlitros
30230506 100 μL 100 microlitros
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 30230693 Supplier Novus Biologicals Supplier No. NBP33321120ul

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

This item is not returnable. View return policy

Description

Rabbit Monoclonal Antibody

Claudin-18.2 Monoclonal antibody specifically detects Claudin-18.2 in Human samples. It is validated for ELISA,Immunohistochemistry,Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antígeno Claudin-18.2
Aplicaciones ELISA, Immunohistochemistry, Immunohistochemistry (Paraffin)
Clasificación Monoclonal
Conjugado Unconjugated
Dilución ELISA Recommended starting concentration is 1 μg/mL, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulación PBS (pH 7.3), 50% glycerol, 0.05% BSA
Alias de gen claudin-18, SFTA5, SFTPJ, surfactant associated 5, surfactant associated protein J, surfactant, pulmonary associated protein J
Especie del huésped Rabbit
Inmunógeno A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Claudin-18.2 (P56856-2).,, Sequence:, MSTTTCQVVAFLLSILGLAGCIAATGMDMWSTQDLYDNPVTSVFQYEGLWRSCVRQSSGFTECRPYFTILGLPAMLQAVRALMIVGIVLGAIGLLVSIFA
Método de purificación Affinity purified
Cantidad 20 μL
Estado normativo RUO
Primario o secundario Primary
ID de gen (Entrez) 51208
Especies diana Human
Contenido y almacenamiento Store at -20°C. Avoid freeze-thaw cycles.
Formulario Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.