missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
Claudin-18.2 Monoclonal antibody specifically detects Claudin-18.2 in Human samples. It is validated for ELISA,Immunohistochemistry,Immunohistochemistry (Paraffin)
Specifications
Specifications
| Antígeno | Claudin-18.2 |
| Aplicaciones | ELISA, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Clasificación | Monoclonal |
| Conjugado | Unconjugated |
| Dilución | ELISA Recommended starting concentration is 1 μg/mL, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Formulación | PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Alias de gen | claudin-18, SFTA5, SFTPJ, surfactant associated 5, surfactant associated protein J, surfactant, pulmonary associated protein J |
| Especie del huésped | Rabbit |
| Inmunógeno | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Claudin-18.2 (P56856-2).,, Sequence:, MSTTTCQVVAFLLSILGLAGCIAATGMDMWSTQDLYDNPVTSVFQYEGLWRSCVRQSSGFTECRPYFTILGLPAMLQAVRALMIVGIVLGAIGLLVSIFA |
| Método de purificación | Affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?