missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CIB1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
391.65€ - 590.10€
Especificaciones
| Antígeno | CIB1 |
|---|---|
| Dilución | Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Aplicaciones | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Clasificación | Polyclonal |
| Conjugado | Unconjugated |
| Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
|---|---|---|---|---|---|---|---|---|---|
| Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
|
18637836
|
Novus Biologicals
NBP2-68646-25ul |
25 μL |
415.00€ 391.65€ / 25 microlitros Ahorro 23.35€ 5% Descuento |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | |||||
|
18663867
|
Novus Biologicals
NBP2-68646 |
100 μg |
624.00€ 590.10€ / 100 microlitros Ahorro 33.90€ 5% Descuento |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | |||||
Descripción
CIB1 Polyclonal antibody specifically detects CIB1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Especificaciones
| CIB1 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Signal Transduction | |
| PBS (pH 7.2) and 40% Glycerol | |
| 10519 | |
| IgG | |
| Protein A purified |
| Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| calcium and integrin binding 1 (calmyrin), Calcium- and integrin-binding protein, calmyrin, CIBcalcium and integrin binding protein, CIBP, DNA-dependent protein kinase interacting protein, DNA-PKcs-interacting protein, Kinase-interacting protein, KIP1, KIPcalcium and integrin binding, protein kinase interacting protein, PRKDCIP, SIP2-28calcium and integrin-binding protein 1, Snk interacting protein 2-28, SNK-interacting protein 2-28 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: SGSRLSKELLAEYQDLTFLTKQEILLAHRRFCELLPQEQRSVESSLRAQVPFEQILSLPELKANPFKERICRVFSTSPAKDSLSFEDFLD | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto