missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Reactivos bioquímicos
  4. Péptidos
  5. 18093479

Novus Biologicals™ CHMP2A Recombinant Protein Antigen

Código de producto. 18093479 Tienda Bio Techne Productos
Change view
Click to view available options
Cantidad:
0,1 mL
Unit Size:
0.10 ml
Product Code. Cantidad unitSize
18093479 0,1 mL 0.10 ml
1 options
This item is not returnable. View return policy

Product Code. 18093479

Brand: Novus Biologicals™ NBP191780PEP

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

This item is not returnable. View return policy

Description

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CHMP2A. The CHMP2A Recombinant Protein Antigen is derived from E. coli. The CHMP2A Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

This is a blocking peptide for NBP1-91780. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.

TRUSTED_SUSTAINABILITY

Specifications

Gene ID (Entrez) 27243
Especie Human
Método de purificación Chromatography
Pureza >80%
Concentración 0.5mg/mL
Contenido y almacenamiento Store at -20°C. Avoid freeze-thaw cycles.
Formulación PBS and 1M Urea, pH 7.4.
Para utilizar con (aplicación) Blocking/Neutralizing, Control
Símbolo de gen CHMP2A
Tipo de etiqueta Unlabeled
Peso molecular 26kDa
Tipo de producto CHMP2A
Cantidad 0,1 mL
Estado normativo RUO
Fuente E.Coli
Reactividad específica This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-91780. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Inmunógeno NIQAVSLKIQTLKSNNSMAQAMKGVTKAMGTMNRQLKLPQIQKIMMEFERQAEIMDMKEEMMNDAIDDAM
Show More Show Less

Para uso exclusivo en investigación

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.