missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CENPB Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
190.00€ - 550.00€
Especificaciones
| Antígeno | CENPB |
|---|---|
| Dilución | Western Blot 1:500 - 1:2000, ELISA |
| Aplicaciones | ELISA, Western Blot |
| Clasificación | Polyclonal |
| Conjugado | Unconjugated |
| Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
|---|---|---|---|---|---|---|---|---|---|
| Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
|
30231510
|
Novus Biologicals
NBP3-35700-100ul |
100 μL |
550.00€
100 microlitros |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | |||||
|
30227166
|
Novus Biologicals
NBP3-35700-20ul |
20 μL |
190.00€
20 microlitros |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | |||||
Beschreibung
CENPB Polyclonal antibody specifically detects CENPB in Mouse,Rat samples. It is validated for ELISA,Western BlotSpezifikation
| CENPB | |
| ELISA, Western Blot | |
| Unconjugated | |
| Rabbit | |
| Cell Cycle and Replication, Chromatin Research, DNA Repair | |
| PBS (pH 7.3), 50% glycerol | |
| 1059 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500 - 1:2000, ELISA | |
| Polyclonal | |
| Purified | |
| RUO | |
| Mouse, Rat | |
| CENP-B, centromere autoantigen B, Centromere protein B, centromere protein B (80kD), centromere protein B, 80kDa, major centromere autoantigen B | |
| A synthetic peptide corresponding to a sequence within amino acids 500 to the C-terminus of human CENPB (NP_001801.1).,, Sequence:, TLHFLEGGEDSDSDSEEEDDEEEDDEDEDDDDDEEDGDEVPVPSFGEAMAYFAMVKRYLTSFPIDDRVQSHILHLEHDLVHVTRKNHARQAGVRGLGHQS | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts