missing translation for 'onlineSavingsMsg'
Learn More

CDCA3 Antibody, Novus Biologicals™

Código de producto. 18425940 Tienda Bio Techne Productos
Change view
Click to view available options
Cantidad:
0.1 mL
25 μL
Tamaño de la unidad:
0.10 ml
25 microlitros
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad unitSize
18425940 0.1 mL 0.10 ml
18449090 25 μL 25 microlitros
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 18425940 Proveedor Novus Biologicals N.º de proveedor NBP183332

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Rabbit Polyclonal Antibody

CDCA3 Polyclonal antibody specifically detects CDCA3 in Human samples. It is validated for Western Blot
TRUSTED_SUSTAINABILITY

Especificaciones

Antígeno CDCA3
Aplicaciones Western Blot
Clasificación Polyclonal
Conjugado Unconjugated
Dilución Western Blot 0.04-0.4 ug/mL
Formulación PBS (pH 7.2) and 40% Glycerol
Alias de gen C8, cell division cycle associated 3, FBXO52, Gene-rich cluster protein C8, GRCC8cell division cycle-associated protein 3, MGC2577, TOME1, TOME-1gene rich cluster, C8, trigger of mitotic entry 1, Trigger of mitotic entry protein 1
Especie del huésped Rabbit
Inmunógeno This antibody was developed against Recombinant Protein corresponding to amino acids:KEEARQPTETPVASQSSDKPSRDPETPRSSGSMRNRWKPNSSKVLGRSPLTILQDDNSPGTLTLRQGKRPSPLSENVSELKEGAILGTGRLLKTGGRAWEQ
Método de purificación Immunogen affinity purified
Cantidad 0.1 mL
Estado normativo RUO
Disciplina de investigación Core ESC Like Genes, Stem Cell Markers
Primario o secundario Primary
ID de gen (Entrez) 83461
Especies diana Human
Contenido y almacenamiento Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Formulario Purified
Isotype IgG
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.