missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CD35 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marca: Novus Biologicals NBP2-13870-25ul
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
CD35 Polyclonal antibody specifically detects CD35 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Especificaciones
| CD35 | |
| Polyclonal | |
| Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| complement component (3b/4b) receptor 1 (Knops blood group), KN | |
| This antibody was developed against a recombinant protein corresponding to the amino acids: LIGSPSTTCLVSGNNVTWDKKAPICEIISCEPPPTISNGDFYSNNRTSFHNGTVVTYQCHTGPDGEQ | |
| 25 μL | |
| Immunology | |
| 1378 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido