missing translation for 'onlineSavingsMsg'
Learn More

CD109 Antibody, Novus Biologicals™

Código de producto. 18605227 Tienda Bio Techne Productos
Change view
Click to view available options
Cantidad:
100 μg
25 μL
Tamaño de la unidad:
100 microlitros
25 microlitros
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad unitSize
18605227 100 μg 100 microlitros
18685318 25 μL 25 microlitros
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 18605227 Proveedor Novus Biologicals N.º de proveedor NBP262598

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Rabbit Polyclonal Antibody

CD109 Polyclonal antibody specifically detects CD109 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antígeno CD109
Aplicaciones Immunohistochemistry, Immunohistochemistry (Paraffin)
Clasificación Polyclonal
Conjugado Unconjugated
Dilución Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
Formulación PBS (pH 7.2) and 40% Glycerol
Alias de gen 150 kDa TGF-beta-1-binding protein, activated T-cell marker CD109, C3 and PZP-like alpha-2-macroglobulin domain-containing protein 7, CD109 antigen, CD109 antigen (Gov platelet alloantigens), CD109 molecule, CPAMD7r150, DKFZp762L1111, FLJ38569, FLJ41966, Gov platelet alloantigens, p180, Platelet-specific Gov antigen, RP11-525G3.1
Especie del huésped Rabbit
Inmunógeno This antibody was developed against a recombinant protein corresponding to amino acids: GPVEILTTVTESVTGISRNVSTNVFFKQHDYIIEFFDYTTVLKPSLNFTATVKVTRADGNQLTLEERRNNVVITVTQRNYTEYWSGSNSGNQKMEAVQKINYTVPQSGTFKIEFPILEDSSELQLKAYFLGSKSSMA
Método de purificación Protein A purified
Cantidad 100 μg
Estado normativo RUO
Disciplina de investigación Cancer, Cell Biology, Cytokine Research, Immunology, Stem Cell Markers
Primario o secundario Primary
ID de gen (Entrez) 135228
Especies diana Human
Contenido y almacenamiento Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Formulario Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.