missing translation for 'onlineSavingsMsg'
Learn More

CCL27/CTACK Antibody, Novus Biologicals™

Código de producto. p-200059460 Tienda Bio Techne Productos
Change view
Click to view available options
Cantidad:
100 μg
25 μL
Tamaño de la unidad:
100 microlitros
25 microlitros
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad unitSize
18644397 25 μL 25 microlitros
18681929 100 μg 100 microlitros
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 18644397 Proveedor Novus Biologicals N.º de proveedor NBP26268425ul

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Rabbit Polyclonal Antibody

CCL27/CTACK Polyclonal antibody specifically detects CCL27/CTACK in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Especificaciones

Antígeno CCL27/CTACK
Aplicaciones Immunohistochemistry, Immunohistochemistry (Paraffin)
Clasificación Polyclonal
Conjugado Unconjugated
Dilución Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
Formulación PBS (pH 7.2) and 40% Glycerol
Alias de gen ALP, C-C motif chemokine 27, chemokine (C-C motif) ligand 27, CTACKSmall-inducible cytokine A27, CTAK, cutaneous T-cell attracting chemokine, Cutaneous T-cell-attracting chemokine, ESKINE, IL-11 Ralpha-locus chemokine, ILCCC chemokine ILC, PESKY, SCYA27IL-11 R-alpha-locus chemokine, skinkine, small inducible cytokine subfamily A (Cys-Cys), member 27
Especie del huésped Rabbit
Inmunógeno This antibody was developed against a recombinant protein corresponding to amino acids: CTQLYRKPLSDKLLRKVIQVELQEADGDCHLQAFVLHLAQRSICIHPQNPSLSQWFEHQERKLHGTLPKLNFGMLR
Método de purificación Protein A purified
Cantidad 25 μL
Estado normativo RUO
Disciplina de investigación Biologically Active Proteins
Primario o secundario Primary
ID de gen (Entrez) 10850
Especies diana Human
Contenido y almacenamiento Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Formulario Purified
Isotype IgG
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.