missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Descripción
CCL27/CTACK Polyclonal antibody specifically detects CCL27/CTACK in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Especificaciones
Especificaciones
| Antígeno | CCL27/CTACK |
| Aplicaciones | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Clasificación | Polyclonal |
| Conjugado | Unconjugated |
| Dilución | Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Formulación | PBS (pH 7.2) and 40% Glycerol |
| Alias de gen | ALP, C-C motif chemokine 27, chemokine (C-C motif) ligand 27, CTACKSmall-inducible cytokine A27, CTAK, cutaneous T-cell attracting chemokine, Cutaneous T-cell-attracting chemokine, ESKINE, IL-11 Ralpha-locus chemokine, ILCCC chemokine ILC, PESKY, SCYA27IL-11 R-alpha-locus chemokine, skinkine, small inducible cytokine subfamily A (Cys-Cys), member 27 |
| Especie del huésped | Rabbit |
| Inmunógeno | This antibody was developed against a recombinant protein corresponding to amino acids: CTQLYRKPLSDKLLRKVIQVELQEADGDCHLQAFVLHLAQRSICIHPQNPSLSQWFEHQERKLHGTLPKLNFGMLR |
| Método de purificación | Protein A purified |
| Mostrar más |
Título del producto
Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.
¿Detecta una oportunidad de mejora?