missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CART/CARTPT Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marca: Novus Biologicals NBP1-91749
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
CART/CARTPT Polyclonal specifically detects CART/CARTPT in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Especificaciones
| CART/CARTPT | |
| Polyclonal | |
| Western Blot 0.4 ug/ml, Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| CART prepropeptide, CARTcocaine and amphetamine regulated transcript, cocaine- and amphetamine-regulated transcript protein | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| CARTPT | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:PRALDIYSAVDDASHEKELIEALQEVLKKLKSKRVPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSF | |
| 0.1 mL | |
| Neuroscience | |
| 9607 | |
| Human | |
| IgG |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
For Research Use Only
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido