missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ CARD4 (Human) Recombinant Protein

Human CARD4 partial ORF ( AAH40339, 1 a.a. - 93 a.a.) recombinant protein with GST-tag at N-terminal.

Marca:  Abnova™ H00010392-Q02.25ug

Detalles adicionales : Peso : 0.02000kg

 Ver más versiones de este producto

Código de producto. 16025245

  • 545.00€ / 25 microgramos
Fecha estimada de envío: 05-07-2022
para ver el stock

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.


Descripción

Descripción

  • Sequence: MEEQGHSEMEIIPSESHPHIQLLKSNRELLVTHIRNTQCLVDNLLKNDYFSAEDAEIVCACPTQPDKVRKILDLVQSKGEEVSEFFLYLLQQL
Especificaciones

Especificaciones

AAH40339
nucleotide-binding oligomerization domain containing 1
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
NOD1
GST
10392
Wheat germ expression system
25 μg
CARD4, CLR7.1, NLRC1
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
SDS
Documentos
Certificados
Ofertas especiales

Ofertas especiales