missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ CARD4 (Human) Recombinant Protein
Human CARD4 partial ORF ( AAH40339, 1 a.a. - 93 a.a.) recombinant protein with GST-tag at N-terminal.
Marca: Abnova™ H00010392-Q02.25ug
Detalles adicionales : Peso : 0.02000kg
Descripción
- Sequence: MEEQGHSEMEIIPSESHPHIQLLKSNRELLVTHIRNTQCLVDNLLKNDYFSAEDAEIVCACPTQPDKVRKILDLVQSKGEEVSEFFLYLLQQL
Especificaciones
| AAH40339 | |
| nucleotide-binding oligomerization domain containing 1 | |
| 125% SDS-PAGE Stained with Coomassie Blue | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| NOD1 | |
| GST |
| 10392 | |
| Wheat germ expression system | |
| 25 μg | |
| CARD4, CLR7.1, NLRC1 | |
| Wheat Germ (in vitro) | |
| 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer |