missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Carbonic Anhydrase IX/CA9 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marca: Novus Biologicals NBP2-54743
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
Carbonic Anhydrase IX/CA9 Polyclonal specifically detects Carbonic Anhydrase IX/CA9 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Especificaciones
| Carbonic Anhydrase IX/CA9 | |
| Polyclonal | |
| Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| CA-IX, CAIXcarbonic anhydrase 9, Carbonate dehydratase IX, carbonic anhydrase IXpMW1, carbonic dehydratase, EC 4.2.1.1, G250, Membrane antigen MN, MNRCC-associated antigen G250, P54/58N, RCC-associated protein G250, Renal cell carcinoma-associated antigen G250 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| CA9 | |
| This antibody was developed against a Recombinant Protein corresponding to amino acids:PCAQGVIWTVFNQTVMLSAKQLHTLSDTLWGPGDSRLQLNFRATQPLNGRVIEASFPAGVDSSPRAAEPVQLNSCL | |
| 100 μL | |
| Cancer, Cellular Markers, HIF Target Genes, Hypoxia, Lipid and Metabolism, Signal Transduction, Vision | |
| 768 | |
| Human | |
| IgG |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
For Research Use Only
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido